PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G16350.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GATA
Protein Properties Length: 393aa    MW: 41218.4 Da    PI: 7.4064
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G16350.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.22.6e-19304338135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  LPERR04G16350.2 304 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 338
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.6E-18298352IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.018298334IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.04E-14301361No hitNo description
Gene3DG3DSA:3.30.50.101.8E-15302336IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.67E-15303360No hitNo description
PROSITE patternPS003440304329IPR000679Zinc finger, GATA-type
PfamPF003202.7E-17304338IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MEPLKSSCRS EDAADEGAAV APAEWAMADR DGFDVEDLLD LEEFVEVDKD GADEQAPVAA  60
APEEEKPKDD SPQQSSVVSY ELVPLPPPPP EIVDLPAHDV EELEWVSHIM DDSLSELPPP  120
PQPPASLVAA AARPPLRRLP QDGAYRALPL PPPASYPLLR TPTICALSTE ALVPVTAKRS  180
KRSRSSAWSL SGASPFSDST SSSSTTTTTS SCSSSAGSFS RASSAAPFSP LLKWQPLGSS  240
DLSEDYQLLM TPPPPGKKSK HGKNGGGKNG KPKKRGRKPK QLPPNPSAAA GAAAAAPAPG  300
DRRCSHCGVQ KTPQWRAGPE GAKTLCNACG VRYKSGRLLP EYRPACSPTY VSAIHSNSHR  360
KVLEMRRKKE AGTGTGTGIL AAAAAAVPAV ASF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015692212.11e-140PREDICTED: GATA transcription factor 5-like
TrEMBLA0A0D9W7P00.0A0A0D9W7P0_9ORYZ; Uncharacterized protein
STRINGOB04G27190.11e-140(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.26e-39GATA transcription factor 5